Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DEFB4 Protein, Human, Recombinant (Active)

Catalog No. TMPH-03814

DEFB4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q8WTQ1.

DEFB4 Protein, Human, Recombinant (Active)

DEFB4 Protein, Human, Recombinant (Active)

Catalog No. TMPH-03814
DEFB4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q8WTQ1.
Pack SizePriceAvailabilityQuantity
5 μg $13020 days
100 μg $1,08020 days
500 μg $2,43020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100.0 ng/ml.
Description
DEFB4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q8WTQ1.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ8WTQ1
Synonyms
Defensin, beta 104,DEFB4,DEFB104B,DEFB104A,DEFB104,Beta-defensin 4 (BD-4;DEFB-4;hBD-4),Beta-defensin 104
Amino Acid
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Construction
23-72 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight6.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords