Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Defensin, beta 104, DEFB4, DEFB104B, DEFB104A, DEFB104, Beta-defensin 4 (BD-4;DEFB-4;hBD-4), Beta-defensin 104


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $130 | 20 days | 20 days | |
| 10 µg | $198 | 20 days | 20 days | |
| 20 µg | $338 | 20 days | 20 days | |
| 50 µg | $655 | 20 days | 20 days | |
| 100 µg | $1,080 | 20 days | 20 days | |
| 200 µg | $1,530 | 20 days | 20 days | |
| 500 µg | $2,430 | 20 days | 20 days |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100.0 ng/ml. |
| Description | DEFB4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q8WTQ1. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q8WTQ1 |
| Amino Acid | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP |
| Construction | 23-72 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Defensin, beta 104, DEFB4, DEFB104B, DEFB104A, DEFB104, Beta-defensin 4 (BD-4;DEFB-4;hBD-4), Beta-defensin 104 |
| Molecular Weight | 6.0 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.