Home Tools
Log in
Cart

DEFB1 Protein, Pig, Recombinant (GST)

Catalog No. TMPH-03101
Synonyms: DEFB1, Defensin, beta 1, Beta-defensin 1, BD-1

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
DEFB1 Protein, Pig, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.
Species Sus scrofa (Pig)
Expression System E. coli
Tag N-GST
Accession Number O62697
Synonyms DEFB1, Defensin, beta 1, Beta-defensin 1, BD-1
Amino Acid NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
Construction 24-64 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 31.1 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

DEFB1 Protein, Pig, Recombinant (GST) DEFB1 Defensin, beta 1 Beta-defensin 1 BD-1 recombinant recombinant-proteins proteins protein

 

TargetMol