DEFB1 Protein, Pig, Recombinant (GST)

Name: DEFB1 Protein, Pig, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-03101
Rating: 4.5 (1 reviews)

(Synonyms: Defensin, beta 1, DEFB1, Beta-defensin 1, BD-1) Copy Product Info

Synonyms: Defensin, beta 1, DEFB1, Beta-defensin 1, BD-1

Catalog No. TMPH-03101 Copy Product Info

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.
Species	Sus scrofa (Pig)
Expression System	E. coli
Tag	N-GST
Accession Number	O62697
Amino Acid	NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
Construction	24-64 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Defensin, beta 1, DEFB1, Beta-defensin 1, BD-1
Research Background	Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Chemical Properties

Molecular Weight

31.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.