Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DEFB1 Protein, Pig, Recombinant (GST)

Catalog No. TMPH-03101

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.

DEFB1 Protein, Pig, Recombinant (GST)

DEFB1 Protein, Pig, Recombinant (GST)

Catalog No. TMPH-03101
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.
Species
Sus scrofa (Pig)
Expression System
E. coli
TagN-GST
Accession NumberO62697
Synonyms
Defensin, beta 1,DEFB1,Beta-defensin 1,BD-1
Amino Acid
NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
Construction
24-64 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight31.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords