Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 284.00 | |
100 μg | 20 days | $ 537.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. DEFB1 Protein, Pig, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 31.1 kDa and the accession number is O62697. |
Species | Sus scrofa (Pig) |
Expression System | E. coli |
Tag | N-GST |
Accession Number | O62697 |
Synonyms | DEFB1, Defensin, beta 1, Beta-defensin 1, BD-1 |
Amino Acid | NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK |
Construction | 24-64 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 31.1 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
DEFB1 Protein, Pig, Recombinant (GST) DEFB1 Defensin, beta 1 Beta-defensin 1 BD-1 recombinant recombinant-proteins proteins protein