Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DEFB103A Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03813

DEFB103A Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P81534.

DEFB103A Protein, Human, Recombinant

DEFB103A Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03813
DEFB103A Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P81534.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$13020 days20 days
10 μg$19820 days20 days
20 μg$33820 days20 days
50 μg$65520 days20 days
100 μg$1,08020 days20 days
200 μg$1,53020 days20 days
500 μg$2,43020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.
Description
DEFB103A Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P81534.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP81534
Synonyms
Defensin-like protein,Defensin, beta 103,DEFB3,DEFB103B,DEFB103A,DEFB103,Beta-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3),Beta-defensin 103,BD3
Amino Acid
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Construction
23-67 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight5.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords