DEFB103A Protein, Human, Recombinant

Name: DEFB103A Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-03813
Rating: 4.5 (1 reviews)

(Synonyms: Defensin-like protein, Defensin, beta 103, DEFB3, DEFB103B, DEFB103A, DEFB103, Beta-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3), Beta-defensin 103, BD3) Copy Product Info

Synonyms: Defensin-like protein, Defensin, beta 103, DEFB3, DEFB103B, DEFB103A, DEFB103, Beta-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3), Beta-defensin 103, BD3

Catalog No. TMPH-03813 Copy Product Info

DEFB103A Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P81534.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$130	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$338	20 days	20 days
50 μg	$655	20 days	20 days
100 μg	$1,080	20 days	20 days
200 μg	$1,530	20 days	20 days
500 μg	$2,430	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of ＞ 33.3 IU/mg.
Description	DEFB103A Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P81534.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P81534
Amino Acid	GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Construction	23-67 aa
Protein Purity	>98% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Defensin-like protein, Defensin, beta 103, DEFB3, DEFB103B, DEFB103A, DEFB103, Beta-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3), Beta-defensin 103, BD3

Chemical Properties

Molecular Weight

5.2 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

β-defensin103βdefensin103β-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3)β-defensin 103βdefensin 103Defensin, β103Defensin, β 103Defensin, beta103Defensin, b103Defensin, b 103DEFB-3DEFB 3DEFB 103Beta-defensin103b-defensin103b-defensin 3 (BD-3;DEFB-3;HBD3;hBD-3)b-defensin 103BD-3BD 3

Related Tags: DEFB103A Protein, Human, Recombinant chemical structure | DEFB103A Protein, Human, Recombinant molecular weight