DEFA1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-01772

Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. DEFA1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 37.2 kDa and the accession number is P59665.

DEFA1 Protein, Human, Recombinant (GST)

Catalog No. TMPH-01772

Pack Size	Price	Availability
5 μg	$105	20 days
10 μg	$169	20 days
20 μg	$283	20 days
50 μg	$428	20 days
100 μg	$590	20 days
200 μg	$913	20 days
500 μg	$1,620	20 days
1 mg	$2,530	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. DEFA1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 37.2 kDa and the accession number is P59665.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P59665
Synonyms	Neutrophil defensin 1,MRS,HNP-1 (HP-1;HP1),Defensin, alpha 1,DEFA2,DEFA1B,DEFA1,DEF1
Amino Acid	DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Construction	1-94 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	37.2 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.