CYP11B2 Protein, Human, Recombinant (His & SUMO)

Name: CYP11B2 Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01181
Price: 105 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Steroid 18-hydroxylase, Steroid 11-beta-hydroxylase, CYP11B2, mitochondrial, Cytochrome P-450C18, Cytochrome P-450Aldo, Cytochrome P450 11B2, mitochondrial, CYPXIB2, CYP11B2, Corticosterone 18-monooxygenase, CYP11B2, Aldosterone-synthesizing enzyme, Aldosterone synthase (ALDOS)) Copy Product Info

Synonyms: Steroid 18-hydroxylase, Steroid 11-beta-hydroxylase, CYP11B2, mitochondrial, Cytochrome P-450C18, Cytochrome P-450Aldo, Cytochrome P450 11B2, mitochondrial, CYPXIB2, CYP11B2, Corticosterone 18-monooxygenase, CYP11B2, Aldosterone-synthesizing enzyme, Aldosterone synthase (ALDOS)

Catalog No. TMPH-01181 Copy Product Info

CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	-	In Stock
10 µg	$169	-	In Stock
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CYP11B2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P19099
Amino Acid	GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Construction	25-503
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Steroid 18-hydroxylase, Steroid 11-beta-hydroxylase, CYP11B2, mitochondrial, Cytochrome P-450C18, Cytochrome P-450Aldo, Cytochrome P450 11B2, mitochondrial, CYPXIB2, CYP11B2, Corticosterone 18-monooxygenase, CYP11B2, Aldosterone-synthesizing enzyme, Aldosterone synthase (ALDOS)
Research Background	A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone. Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21-hydroxyprogesterone, namely 11-beta hydroxylation followed with two successive oxidations at C18 to yield 18-hydroxy and then 18-aldehyde derivatives, resulting in the formation of aldosterone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin).

Chemical Properties

Molecular Weight

71.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.