Shopping Cart
Remove All
Your shopping cart is currently empty
CXCL9 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P18340.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $147 | 7-10 days | 7-10 days | |
| 10 μg | $223 | 7-10 days | 7-10 days | |
| 20 μg | $382 | 7-10 days | 7-10 days | |
| 50 μg | $739 | 7-10 days | 7-10 days | |
| 100 μg | $1,220 | 7-10 days | 7-10 days | |
| 200 μg | $1,720 | 7-10 days | 7-10 days | |
| 500 μg | $2,730 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml. |
| Description | CXCL9 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P18340. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P18340 |
| Synonyms | Small-inducible cytokine B9,Scyb9,Protein m119,Monokine induced by interferon-gamma (MIG;MuMIG),Mig,Gamma-interferon-induced monokine,Cxcl9,C-X-C motif chemokine 9 |
| Amino Acid | TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT |
| Construction | 22-126 |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 12.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in 2 × PBS, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.