Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CXCL17 Protein, Human, Recombinant

TargetMol | SPR
Catalog No. TMPH-04189

CXCL17 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6UXB2.

CXCL17 Protein, Human, Recombinant

CXCL17 Protein, Human, Recombinant

TargetMol | SPR
Catalog No. TMPH-04189
CXCL17 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6UXB2.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$147-In Stock
10 μg$223-In Stock
20 μg$382-In Stock
50 μg$739-In Stock
100 μg$1,220-In Stock
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg.
Description
CXCL17 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q6UXB2.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ6UXB2
Synonyms
VEGF coregulated chemokine 1,VCC1,Dendritic cell and monocyte chemokine-like protein (DMC),CXCL17,C-X-C motif chemokine 17,6-Cys CXCL17
Amino Acid
SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Construction
22-119 aa
Protein Purity
>96% as determined by SDS-PAGE.
Molecular Weight11.5 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, with 3 % Trehalose.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords