Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CXCL16 Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04248 Copy Product Info
CXCL16 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8BSU2.

CXCL16 Protein, Mouse, Recombinant

Catalog No. TMPH-04248
Copy Product Info
TargetMol | SPR

CXCL16 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8BSU2.

CXCL16 Protein, Mouse, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$1477-10 days7-10 days
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 20-1000 ng/ml.
Description
CXCL16 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8BSU2.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ8BSU2
Synonyms
Transmembrane chemokine CXCL16,Srpsox,Small-inducible cytokine B16,Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein (SR-PSOX),Cxcl16,C-X-C motif chemokine 16
Amino Acid
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
Construction
27-114 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight9.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords