Shopping Cart
Remove All
Your shopping cart is currently empty
CXCL14 Protein, Mouse, Recombinant (Active)
(Synonyms: Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine) Copy Product InfoSynonyms: Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine
Catalog No. TMPH-04247 Copy Product Info
CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $147 | - | In Stock | |
| 10 μg | $223 | - | In Stock | |
| 20 μg | $382 | - | In Stock | |
| 50 μg | $739 | - | In Stock | |
| 100 μg | $1,220 | - | In Stock | |
| 200 μg | $1,720 | 7-10 days | 7-10 days | |
| 500 μg | $2,730 | 7-10 days | 7-10 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:>95% as determined by SDS-PAGE
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml. |
| Description | CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q9WUQ5 |
| Amino Acid | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Construction | 23-99 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 400 mM NaCl, pH 7.4, 5 % trehalose. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine |
| Molecular Weight | 9.4 kDa (Predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: CXCL14 Protein, Mouse, Recombinant (Active) chemical structure | CXCL14 Protein, Mouse, Recombinant (Active) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.