Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CXCL14 Protein, Mouse, Recombinant (Active)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04247

CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.

CXCL14 Protein, Mouse, Recombinant (Active)

CXCL14 Protein, Mouse, Recombinant (Active)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04247
CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$147-In Stock
10 μg$223-In Stock
20 μg$382-In Stock
50 μg$739-In Stock
100 μg$1,220-In Stock
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Description
CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ9WUQ5
Synonyms
Small-inducible cytokine B14,Scyb14,MIP-2G,Mip2g,Ks1,Kidney-expressed chemokine CXC,Kec,Cxcl14,C-X-C motif chemokine 14,Chemokine BRAK,Bmac,B-cell and monocyte-activating chemokine
Amino Acid
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Construction
23-99 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight9.4 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 400 mM NaCl, pH 7.4, 5 % trehalose.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords