CXCL14 Protein, Mouse, Recombinant (Active)

Name: CXCL14 Protein, Mouse, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-04247
Price: 147 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine) Copy Product Info

Synonyms: Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine

Catalog No. TMPH-04247 Copy Product Info

CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	-	In Stock
10 µg	$223	-	In Stock
20 µg	$382	-	In Stock
50 µg	$739	-	In Stock
100 µg	$1,220	-	In Stock
200 µg	$1,720	7-10 days	7-10 days
500 µg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:>95% as determined by SDS-PAGE

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Description	CXCL14 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9WUQ5.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	Q9WUQ5
Amino Acid	SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Construction	23-99 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 400 mM NaCl, pH 7.4, 5 % trehalose.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small-inducible cytokine B14, Scyb14, MIP-2G, Mip2g, Ks1, Kidney-expressed chemokine CXC, Kec, Cxcl14, C-X-C motif chemokine 14, Chemokine BRAK, Bmac, B-cell and monocyte-activating chemokine

Chemical Properties

Molecular Weight

9.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.