CX3CL1/Fractalkine Protein, Mouse, Recombinant

Name: CX3CL1/Fractalkine Protein, Mouse, Recombinant
Brand: TargetMol
SKU: TMPH-04271
Rating: 4.5 (1 reviews)

(Synonyms: Small-inducible cytokine D1, Scyd1, Neurotactin, Fractalkine, Fkn, FK, Cx3cl1, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Cx3c, ABCD-3) Copy Product Info

Synonyms: Small-inducible cytokine D1, Scyd1, Neurotactin, Fractalkine, Fkn, FK, Cx3cl1, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Cx3c, ABCD-3

Catalog No. TMPH-04271 Copy Product Info

CX3CL1/Fractalkine Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35188.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	7-10 days	7-10 days
10 µg	$246	7-10 days	7-10 days
20 µg	$416	7-10 days	7-10 days
50 µg	$853	7-10 days	7-10 days
100 µg	$1,460	7-10 days	7-10 days
200 µg	$1,980	7-10 days	7-10 days
500 µg	$3,300	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of ＞ 2000 IU/mg.
Description	CX3CL1/Fractalkine Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35188.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	O35188
Amino Acid	QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG
Construction	25-100 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small-inducible cytokine D1, Scyd1, Neurotactin, Fractalkine, Fkn, FK, Cx3cl1, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Cx3c, ABCD-3

Chemical Properties

Molecular Weight

8.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.