Shopping Cart
Remove All
Your shopping cart is currently empty
CX3CL1/Fractalkine Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35188.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $147 | 7-10 days | 7-10 days | |
| 10 μg | $246 | 7-10 days | 7-10 days | |
| 20 μg | $416 | 7-10 days | 7-10 days | |
| 50 μg | $853 | 7-10 days | 7-10 days | |
| 100 μg | $1,460 | 7-10 days | 7-10 days | |
| 200 μg | $1,980 | 7-10 days | 7-10 days | |
| 500 μg | $3,300 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg. |
| Description | CX3CL1/Fractalkine Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35188. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | O35188 |
| Synonyms | Small-inducible cytokine D1,Scyd1,Neurotactin,Fractalkine,Fkn,FK,Cx3cl1,C-X3-C motif chemokine 1,CX3C membrane-anchored chemokine,Cx3c,ABCD-3 |
| Amino Acid | QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG |
| Construction | 25-100 aa |
| Protein Purity | >97% as determined by SDS-PAGE. |
| Molecular Weight | 8.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.