Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CTAG1A Protein, Human, Recombinant (hFc & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01034

CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.

CTAG1A Protein, Human, Recombinant (hFc & Myc)

CTAG1A Protein, Human, Recombinant (hFc & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01034
CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.
Pack SizePriceAvailabilityQuantity
5 μg$21920 days
10 μg$36520 days
20 μg$61320 days
50 μg$1,16020 days
100 μg$1,89020 days
200 μg$2,97020 days
500 μg$5,68020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.
Species
Human
Expression System
HEK293 Cells
TagC-hFc-Myc
Accession NumberP78358
Synonyms
LAGE2B,LAGE2A,LAGE2,L antigen family member 2 (LAGE-2),ESO1,CTAG1B,CTAG1A,CTAG1,CTAG,Cancer/testis antigen 6.1 (CT6.1),Cancer/testis antigen 1,Autoimmunogenic cancer/testis antigen NY-ESO-1
Amino Acid
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Construction
1-180 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight48.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords