CTAG1A Protein, Human, Recombinant (hFc & Myc)

Catalog No. TMPH-01034 Copy Product Info

CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.

CTAG1A Protein, Human, Recombinant (hFc & Myc)

Catalog No. TMPH-01034

Copy Product Info

CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.

Pack Size	Price	USA Stock	Global Stock
5 μg	$219	20 days	20 days
10 μg	$365	20 days	20 days
20 μg	$613	20 days	20 days
50 μg	$1,160	20 days	20 days
100 μg	$1,890	20 days	20 days
200 μg	$2,970	20 days	20 days
500 μg	$5,680	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc-Myc
Accession Number	P78358
Synonyms	LAGE2B,LAGE2A,LAGE2,L antigen family member 2 (LAGE-2),ESO1,CTAG1B,CTAG1A,CTAG1,CTAG,Cancer/testis antigen 6.1 (CT6.1),Cancer/testis antigen 1,Autoimmunogenic cancer/testis antigen NY-ESO-1
Amino Acid	MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Construction	1-180 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	48.1 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.