Shopping Cart
- Remove All
- Your shopping cart is currently empty
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $129 | 20 days | |
10 μg | $216 | 20 days | |
20 μg | $360 | 20 days | |
50 μg | $543 | 20 days | |
100 μg | $745 | 20 days | |
200 μg | $1,070 | 20 days | |
500 μg | $1,730 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068. |
Species | Bacillus thuringiensis subsp. kurstaki |
Expression System | E. coli |
Tag | N-GST |
Accession Number | P05068 |
Synonyms | Pesticidal crystal protein Cry1Ac,Insecticidal delta-endotoxin CryIA(c),Crystaline entomocidal protoxin,cryIA(c),cry218,cry1Ac,cry1A(c),133 kDa crystal protein |
Amino Acid | LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Construction | 972-1178 aa |
Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
Molecular Weight | 50.8 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.