Home Tools
Log in
Cart

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Catalog No. TMPH-00183
Synonyms: cryIA(c), Insecticidal delta-endotoxin CryIA(c), Pesticidal crystal protein Cry1Ac, cry218, cry1Ac, 133 kDa crystal protein, cry1A(c), Crystaline entomocidal protoxin

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Species Bacillus thuringiensis subsp. kurstaki
Expression System E. coli
Tag N-GST
Accession Number P05068
Synonyms cryIA(c), Insecticidal delta-endotoxin CryIA(c), Pesticidal crystal protein Cry1Ac, cry218, cry1Ac, 133 kDa crystal protein, cry1A(c), Crystaline entomocidal protoxin
Amino Acid LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Construction 972-1178 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 50.8 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) cryIA(c) Insecticidal delta-endotoxin CryIA(c) Pesticidal crystal protein Cry1Ac cry218 cry1Ac 133 kDa crystal protein cry1A(c) Crystaline entomocidal protoxin recombinant recombinant-proteins proteins protein

 

TargetMol