Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068. |
Species | Bacillus thuringiensis subsp. kurstaki |
Expression System | E. coli |
Tag | N-GST |
Accession Number | P05068 |
Synonyms | cryIA(c), Insecticidal delta-endotoxin CryIA(c), Pesticidal crystal protein Cry1Ac, cry218, cry1Ac, 133 kDa crystal protein, cry1A(c), Crystaline entomocidal protoxin |
Amino Acid | LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Construction | 972-1178 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 50.8 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) cryIA(c) Insecticidal delta-endotoxin CryIA(c) Pesticidal crystal protein Cry1Ac cry218 cry1Ac 133 kDa crystal protein cry1A(c) Crystaline entomocidal protoxin recombinant recombinant-proteins proteins protein