Shopping Cart
- Remove All
- Your shopping cart is currently empty
CR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P17927.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $132 | 20 days | |
10 μg | $217 | 20 days | |
20 μg | $362 | 20 days | |
50 μg | $456 | 20 days | |
100 μg | $543 | 20 days | |
200 μg | $779 | 20 days | |
500 μg | $1,260 | 20 days | |
1 mg | $1,830 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
Description | CR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P17927. |
Species | Human |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P17927 |
Synonyms | CR1,Complement receptor type 1,CD35,C3BR,C3b/C4b receptor |
Amino Acid | GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII |
Construction | 41-234 aa |
Protein Purity | >85% as determined by SDS-PAGE. |
Molecular Weight | 21.6 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.