Home Tools
Log in
Cart

COX5A Protein, Human, Recombinant (GST)

Catalog No. TMPH-01180
Synonyms: Cytochrome c oxidase polypeptide Va, Cytochrome c oxidase subunit 5A, mitochondrial, COX5A

COX5A Protein, Human, Recombinant (GST) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
COX5A Protein, Human, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description COX5A Protein, Human, Recombinant (GST) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-terminal GST-tagged
Accession Number P20674
Synonyms Cytochrome c oxidase polypeptide Va, Cytochrome c oxidase subunit 5A, mitochondrial, COX5A
Amino Acid SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 42-150 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 39.5 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

COX5A Protein, Human, Recombinant (GST) Cytochrome c oxidase polypeptide Va Cytochrome c oxidase subunit 5A, mitochondrial COX5A recombinant recombinant-proteins proteins protein

 

TargetMol