Home Tools
Log in
Cart

Conglutin-7 Protein, Arachis hypogaea, Recombinant (His)

Catalog No. TMPH-00119
Synonyms: 2S protein 1, Conglutin-7, Seed storage protein SSP2, Ara h 2, Seed storage protein SSP1

Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Conglutin-7 Protein, Arachis hypogaea, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2.
Species Arachis hypogaea
Expression System E. coli
Tag N-6xHis
Accession Number Q6PSU2
Synonyms 2S protein 1, Conglutin-7, Seed storage protein SSP2, Ara h 2, Seed storage protein SSP1
Amino Acid RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Construction 22-172 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 22.0 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Weak inhibitor of trypsin.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) 2S protein 1 Conglutin-7 Seed storage protein SSP2 Ara h 2 Seed storage protein SSP1 recombinant recombinant-proteins proteins protein

 

TargetMol