Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2. |
Species | Arachis hypogaea |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q6PSU2 |
Synonyms | 2S protein 1, Conglutin-7, Seed storage protein SSP2, Ara h 2, Seed storage protein SSP1 |
Amino Acid | RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
Construction | 22-172 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 22.0 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Weak inhibitor of trypsin. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) 2S protein 1 Conglutin-7 Seed storage protein SSP2 Ara h 2 Seed storage protein SSP1 recombinant recombinant-proteins proteins protein