Shopping Cart
Remove All
Your shopping cart is currently empty
Conglutin-7 Protein, Arachis hypogaea, Recombinant (His)
(Synonyms: Seed storage protein SSP2, Seed storage protein SSP1, Conglutin-7, 2S protein 1) Copy Product InfoSynonyms: Seed storage protein SSP2, Seed storage protein SSP1, Conglutin-7, 2S protein 1
Catalog No. TMPH-00119 Copy Product Info
Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2. |
| Species | Arachis hypogaea |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q6PSU2 |
| Amino Acid | RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
| Construction | 22-172 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Seed storage protein SSP2, Seed storage protein SSP1, Conglutin-7, 2S protein 1 |
| Research Background | Weak inhibitor of trypsin. |
| Molecular Weight | 22.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Keywords
Preview
Related Tags: Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) chemical structure | Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.