Home Tools
Log in
Cart

Con-ikot-ikot Protein, Conus striatus, Recombinant (His)

Catalog No. TMPH-00429
Synonyms: Con-ikot-ikot, CII

Con-ikot-ikot Protein, Conus striatus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P0CB20.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Con-ikot-ikot Protein, Conus striatus, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Con-ikot-ikot Protein, Conus striatus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P0CB20.
Species Conus striatus
Expression System E. coli
Tag N-6xHis
Accession Number P0CB20
Synonyms Con-ikot-ikot, CII
Amino Acid SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Construction 38-123 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 13.4 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide. The toxin acts like a straightjacket on the ligand-binding domain (LBD) 'gating ring' of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD 'clamshells' is transduced into an irislike expansion of the gating ring. Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Con-ikot-ikot Protein, Conus striatus, Recombinant (His) Con-ikot-ikot CII recombinant recombinant-proteins proteins protein

 

TargetMol