Coagulation factor V Protein, Human, Recombinant (His & SUMO)

Catalog No. TMPH-01107 Copy Product Info

Coagulation factor V Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.

Coagulation factor V Protein, Human, Recombinant (His & SUMO)

Catalog No. TMPH-01107

Copy Product Info

Coagulation factor V Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	-	In Stock
10 μg	$119	-	In Stock
20 μg	$198	-	In Stock
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Coagulation factor V Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P12259
Synonyms	Proaccelerin, labile factor,F5,Coagulation factor V,Activated protein C cofactor
Amino Acid	MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT
Construction	1490-1614 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	30.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.