Home Tools
Log in
Cart

Claudin-3 Protein, Human, Recombinant (B2M & His)

Catalog No. TMPH-01102
Synonyms: Rat ventral prostate.1 protein homolog, hRVP1, CPE-receptor 2, CLDN3, Claudin-3, CPE-R 2, Clostridium perfringens enterotoxin receptor 2, CPETR2, C7orf1

Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Claudin-3 Protein, Human, Recombinant (B2M & His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 237.00
100 μg 20 days $ 446.00
1 mg 20 days $ 1,920.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.
Species Human
Expression System E. coli
Tag N-terminal 6xHis-B2M-tagged
Accession Number O15551
Synonyms Rat ventral prostate.1 protein homolog, hRVP1, CPE-receptor 2, CLDN3, Claudin-3, CPE-R 2, Clostridium perfringens enterotoxin receptor 2, CPETR2, C7orf1
Amino Acid RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 30-80 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 19.7 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Claudin-3 Protein, Human, Recombinant (B2M & His) Rat ventral prostate.1 protein homolog hRVP1 CPE-receptor 2 CLDN3 Claudin-3 CPE-R 2 Clostridium perfringens enterotoxin receptor 2 CPETR2 C7orf1 recombinant recombinant-proteins proteins protein

 

TargetMol