Claudin-3 Protein, Human, Recombinant (B2M & His)

Catalog No. TMPH-01102 Copy Product Info

Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.

Claudin-3 Protein, Human, Recombinant (B2M & His)

Catalog No. TMPH-01102

Copy Product Info

Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 μg	$89	20 days	20 days
10 μg	$143	20 days	20 days
20 μg	$237	20 days	20 days
50 μg	$358	20 days	20 days
100 μg	$490	20 days	20 days
200 μg	$755	20 days	20 days
500 μg	$1,330	20 days	20 days
1 mg	$2,080	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping date USA Stock [1-2d] Global Stock [5-7d]

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-B2M
Accession Number	O15551
Synonyms	Rat ventral prostate.1 protein homolog (hRVP1),CPETR2,Clostridium perfringens enterotoxin receptor 2 (CPE-R 2;CPE-receptor 2),CLDN3,Claudin-3,C7orf1
Amino Acid	RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Construction	30-80 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	19.7 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.