Home Tools
Log in
Cart

CKM Protein, Feline, Recombinant

Catalog No. TMPH-00352
Synonyms: M-CK, Creatine kinase M-type, Creatine phosphokinase M-type, CKM, Creatine kinase M chain

CKM Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 27.9 kDa and the accession number is M3VYX8.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CKM Protein, Feline, Recombinant
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 515.00
100 μg 20 days $ 833.00
1 mg 20 days $ 2,450.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description CKM Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 27.9 kDa and the accession number is M3VYX8.
Species Feline
Expression System E. coli
Tag Tag Free
Accession Number M3VYX8
Synonyms M-CK, Creatine kinase M-type, Creatine phosphokinase M-type, CKM, Creatine kinase M chain
Amino Acid SIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Construction 179-424 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 27.9 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CKM Protein, Feline, Recombinant M-CK Creatine kinase M-type Creatine phosphokinase M-type CKM Creatine kinase M chain recombinant recombinant-proteins proteins protein

 

TargetMol