CHRNB2 Protein, Human, Recombinant (His & V5)

Catalog No. TMPH-01763

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions. CHRNB2 Protein, Human, Recombinant (His & V5) is expressed in E. coli expression system with N-10xHis-V5 tag. The predicted molecular weight is 31.9 kDa and the accession number is P17787.

CHRNB2 Protein, Human, Recombinant (His & V5)

Catalog No. TMPH-01763

Pack Size	Price	Availability
5 μg	$105	20 days
10 μg	$169	20 days
20 μg	$283	20 days
50 μg	$428	20 days
100 μg	$590	20 days
200 μg	$913	20 days
500 μg	$1,620	20 days
1 mg	$2,530	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions. CHRNB2 Protein, Human, Recombinant (His & V5) is expressed in E. coli expression system with N-10xHis-V5 tag. The predicted molecular weight is 31.9 kDa and the accession number is P17787.
Species	Human
Expression System	E. coli
Tag	N-10xHis-V5
Accession Number	P17787
Synonyms	Neuronal acetylcholine receptor subunit beta-2,CHRNB2
Amino Acid	TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK
Construction	26-233 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	31.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.