CHI3L4 Protein, Mouse, Recombinant (His)

Name: CHI3L4 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02578
Rating: 4.5 (1 reviews)

(Synonyms: Ym2, Secreted protein Ym2, Chitinase-like protein 4, Chitinase-3-like protein 4, Chil4, Chi3l4) Copy Product Info

Synonyms: Ym2, Secreted protein Ym2, Chitinase-like protein 4, Chitinase-3-like protein 4, Chil4, Chi3l4

Catalog No. TMPH-02578 Copy Product Info

Has low chemotactic activity for eosinophils. May play a role in inflammation and allergy. Has no chitinase activity.

CHI3L4 Protein, Mouse, Recombinant (His)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,230	20 days	20 days
500 μg	$1,980	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Has low chemotactic activity for eosinophils. May play a role in inflammation and allergy. Has no chitinase activity.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q91Z98
Amino Acid	YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL
Construction	22-402 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Ym2, Secreted protein Ym2, Chitinase-like protein 4, Chitinase-3-like protein 4, Chil4, Chi3l4
Research Background

Chemical Properties

Molecular Weight

44.9 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Ym 2Secreted protein Ym-2Chil 4Chi3l 4

Related Tags: CHI3L4 Protein, Mouse, Recombinant (His) chemical structure | CHI3L4 Protein, Mouse, Recombinant (His) molecular weight