Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: mopA, groL, groEL, Chaperonin-60 (Cpn60), Chaperonin GroEL, 60 kDa chaperonin


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $98 | 20 days | 20 days | |
| 10 µg | $159 | 20 days | 20 days | |
| 20 µg | $266 | 20 days | 20 days | |
| 50 µg | $378 | 20 days | 20 days | |
| 100 µg | $498 | 20 days | 20 days | |
| 200 µg | $769 | 20 days | 20 days | |
| 500 µg | $1,370 | 20 days | 20 days | |
| 1 mg | $2,130 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Chaperonin GroEL Protein, Francisella tularensis, Recombinant (His) is expressed in E. coli. The accession number is P94798. |
| Species | Francisella tularensis subsp. holarctica (strain LVS) |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P94798 |
| Amino Acid | EDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGV |
| Construction | 184-376 aa |
| Protein Purity | > 95% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | mopA, groL, groEL, Chaperonin-60 (Cpn60), Chaperonin GroEL, 60 kDa chaperonin |
| Molecular Weight | 28.1 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 355 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.