Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CEACAM8 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03833

CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.

CEACAM8 Protein, Human, Recombinant (His)

CEACAM8 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03833
CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.
Pack SizePriceAvailabilityQuantity
5 μg$4320 days
10 μg$6620 days
20 μg$10620 days
50 μg$17920 days
100 μg$27020 days
200 μg$47220 days
500 μg$98020 days
1 mg$1,77020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.
Description
CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberP31997
Synonyms
Non-specific cross-reacting antigen NCA-95,CGM6,Cell adhesion molecule CEACAM8,CEACAM8,CD67 antigen,CD66b,Carcinoembryonic antigen-related cell adhesion molecule 8 (CEA cell adhesion molecule 8),Carcinoembryonic antigen CGM6
Amino Acid
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Construction
35-320 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight34.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords