Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CEACAM8 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03833 Copy Product Info
CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.

CEACAM8 Protein, Human, Recombinant (His)

Catalog No. TMPH-03833
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.

CEACAM8 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$4320 days20 days
10 μg$6620 days20 days
20 μg$10620 days20 days
50 μg$17920 days20 days
100 μg$27020 days20 days
200 μg$47220 days20 days
500 μg$98020 days20 days
1 mg$1,77020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.
Description
CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberP31997
Synonyms
Non-specific cross-reacting antigen NCA-95,CGM6,Cell adhesion molecule CEACAM8,CEACAM8,CD67 antigen,CD66b,Carcinoembryonic antigen-related cell adhesion molecule 8 (CEA cell adhesion molecule 8),Carcinoembryonic antigen CGM6
Amino Acid
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Construction
35-320 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight34.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords