CEACAM8 Protein, Human, Recombinant (His)

Name: CEACAM8 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03833
Rating: 4.5 (1 reviews)

(Synonyms: Non-specific cross-reacting antigen NCA-95, CGM6, Cell adhesion molecule CEACAM8, CEACAM8, CD67 antigen, CD66b, Carcinoembryonic antigen-related cell adhesion molecule 8 (CEA cell adhesion molecule 8), Carcinoembryonic antigen CGM6) Copy Product Info

Synonyms: Non-specific cross-reacting antigen NCA-95, CGM6, Cell adhesion molecule CEACAM8, CEACAM8, CD67 antigen, CD66b, Carcinoembryonic antigen-related cell adhesion molecule 8 (CEA cell adhesion molecule 8), Carcinoembryonic antigen CGM6

Catalog No. TMPH-03833 Copy Product Info

CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$43	20 days	20 days
10 µg	$66	20 days	20 days
20 µg	$106	20 days	20 days
50 µg	$179	20 days	20 days
100 µg	$270	20 days	20 days
200 µg	$472	20 days	20 days
500 µg	$980	20 days	20 days
1 mg	$1,770	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.
Description	CEACAM8 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P31997.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P31997
Amino Acid	QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Construction	35-320 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Non-specific cross-reacting antigen NCA-95, CGM6, Cell adhesion molecule CEACAM8, CEACAM8, CD67 antigen, CD66b, Carcinoembryonic antigen-related cell adhesion molecule 8 (CEA cell adhesion molecule 8), Carcinoembryonic antigen CGM6

Chemical Properties

Molecular Weight

34.3 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.