CDK5 Protein, Human, Recombinant

Name: CDK5 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-01171
Rating: 4.5 (1 reviews)

(Synonyms: Tau protein kinase II catalytic subunit (TPKII catalytic subunit), Serine/threonine-protein kinase PSSALRE, PSSALRE, Cyclin-dependent-like kinase 5, Cyclin-dependent kinase 5, Cell division protein kinase 5, CDKN5, CDK5) Copy Product Info

Synonyms: Tau protein kinase II catalytic subunit (TPKII catalytic subunit), Serine/threonine-protein kinase PSSALRE, PSSALRE, Cyclin-dependent-like kinase 5, Cyclin-dependent kinase 5, Cell division protein kinase 5, CDKN5, CDK5

Catalog No. TMPH-01171 Copy Product Info

CDK5 Protein, Human, Recombinant is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 μg	$132	20 days	20 days
10 μg	$217	20 days	20 days
20 μg	$362	20 days	20 days
50 μg	$479	20 days	20 days
100 μg	$598	20 days	20 days
200 μg	$856	20 days	20 days
500 μg	$1,370	20 days	20 days
1 mg	$1,980	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CDK5 Protein, Human, Recombinant is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	Q00535
Amino Acid	MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Construction	1-292 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Tau protein kinase II catalytic subunit (TPKII catalytic subunit), Serine/threonine-protein kinase PSSALRE, PSSALRE, Cyclin-dependent-like kinase 5, Cyclin-dependent kinase 5, Cell division protein kinase 5, CDKN5, CDK5
Research Background

Chemical Properties

Molecular Weight

33.4 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TPKII catalytic subunitCDKN 5CDK 5

Related Tags: CDK5 Protein, Human, Recombinant chemical structure | CDK5 Protein, Human, Recombinant molecular weight