Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CDK4 Protein, Human, Recombinant (Baculovirus, His)

TargetMol | SPR
Catalog No. TMPH-04676

CDK4 Protein, Human, Recombinant (Baculovirus, His) is expressed in Baculovirus. The accession number is P11802.

CDK4 Protein, Human, Recombinant (Baculovirus, His)

CDK4 Protein, Human, Recombinant (Baculovirus, His)

TargetMol | SPR
Catalog No. TMPH-04676
CDK4 Protein, Human, Recombinant (Baculovirus, His) is expressed in Baculovirus. The accession number is P11802.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$14820 days20 days
10 μg$24820 days20 days
20 μg$41520 days20 days
50 μg$74320 days20 days
100 μg$1,16020 days20 days
200 μg$1,48020 days20 days
500 μg$2,13020 days20 days
1 mg$2,78020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CDK4 Protein, Human, Recombinant (Baculovirus, His) is expressed in Baculovirus. The accession number is P11802.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-6xHis
Accession NumberP11802
Synonyms
PSK-J3,Cyclin-dependent kinase 4,Cell division protein kinase 4,CDK4
Amino Acid
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Construction
2-303 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight35.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 313 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords