CD300LB Protein, Human, Recombinant (His) is expressed in E. coli.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | CD300LB Protein, Human, Recombinant (His) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 10xHis-tagged |
Accession Number | A8K4G0 |
Synonyms | CMRF35-like molecule 7, CD300LB, CMRF35A2, CD300b, TREM-5, Leukocyte mono-Ig-like receptor 5, IREM-3, Triggering receptor expressed on myeloid cells 5, CLM-7, CLM7, TREM5, LMIR5, Immune receptor expressed on myeloid cells 3, IREM3, CD300 antigen-like family member B, CMRF35-A2 |
Amino Acid | IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 18-151 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 18.8 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CD300LB Protein, Human, Recombinant (His) CMRF35-like molecule 7 CD300LB CMRF35A2 CD300b TREM-5 Leukocyte mono-Ig-like receptor 5 IREM-3 Triggering receptor expressed on myeloid cells 5 CLM-7 CLM7 TREM5 LMIR5 Immune receptor expressed on myeloid cells 3 IREM3 CD300 antigen-like family member B CMRF35-A2 recombinant recombinant-proteins proteins protein