Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

EMMPRIN/CD147 Protein, Human, Recombinant (aa 138-323, hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00998 Copy Product Info
CD147 Protein, Human, Recombinant (aa 138-323, hFc) is expressed in HEK293.

EMMPRIN/CD147 Protein, Human, Recombinant (aa 138-323, hFc)

Catalog No. TMPH-00998
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

CD147 Protein, Human, Recombinant (aa 138-323, hFc) is expressed in HEK293.

EMMPRIN/CD147 Protein, Human, Recombinant (aa 138-323, hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$3920 days20 days
10 μg$5920 days20 days
20 μg$9320 days20 days
50 μg$16520 days20 days
100 μg$25820 days20 days
200 μg$47320 days20 days
500 μg$1,06020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CD147 Protein, Human, Recombinant (aa 138-323, hFc) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP35613
Synonyms
Tumor cell-derived collagenase stimulatory factor (TCSF),OK blood group antigen,Leukocyte activation antigen M6,Hepatoma-associated antigen (HAb18G),Extracellular matrix metalloproteinase inducer (EMMPRIN),Collagenase stimulatory factor,CD147,BSG,Basigin,5F7
Amino Acid
EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
Construction
138-323 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight49.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Essential for normal retinal maturation and development. Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors. In association with glucose transporter SLC16A1/GLUT1 and NXNL1, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors. May act as a potent stimulator of IL6 secretion in multiple cell lines that include monocytes.; Signaling receptor for cyclophilins, essential for PPIA/CYPA and PPIB/CYPB-dependent signaling related to chemotaxis and adhesion of immune cells. Plays an important role in targeting monocarboxylate transporters SLC16A1/GLUT1, SLC16A11 and SLC16A12 to the plasma membrane. Acts as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells enhancing its VEGFA-mediated activation and downstream signaling. Promotes angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA (isoform VEGF-165 and VEGF-121) and KDR/VEGFR2 in endothelial cells. Plays a key role in regulating tumor growth, invasion, metastasis and neoangiogenesis by stimulating the production and release of extracellular matrix metalloproteinases and KDR/VEGFR2 by both tumor cells and stromal cells (fibroblasts and endothelial cells).; (Microbial infection) Erythrocyte receptor for P.falciparum RH5 which is essential for erythrocyte invasion by the merozoite stage of P.falciparum isolates 3D7 and Dd2.; (Microbial infection) Erythrocyte receptor for P.falciparum RH5 which is essential for erythrocyte invasion by the merozoite stage of P.falciparum isolates 3D7, Dd2, 7G8 and HB3. Binding of P.falciparum RH5 results in BSG dimerization which triggers an increase in intracellular Ca(2+) in the erythrocyte. This essential step leads to a rearrangement of the erythrocyte cytoskeleton required for the merozoite invasion.; (Microbial infection) Can facilitate human SARS coronavirus (SARS-CoV-1) infection via its interaction with virus-associated PPIA/CYPA.; (Microbial infection) Can facilitate HIV-1 infection via its interaction with virus-associated PPIA/CYPA.; (Microbial infection) First described as a receptor for severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), it is not required for SARS-CoV-2 infection.; (Microbial infection) Acts as a receptor for measles virus.; (Microbial infection) Promotes entry of pentamer-expressing human cytomegalovirus (HCMV) into epithelial and endothelial cells.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords