Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL8 Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-03857

CCL8 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P80075.

CCL8 Protein, Human, Recombinant (Active)

CCL8 Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-03857
CCL8 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P80075.
Pack SizePriceAvailabilityQuantity
5 μg$19720 days
10 μg$32820 days
20 μg$46820 days
50 μg$75320 days
100 μg$1,08020 days
200 μg$1,53020 days
500 μg$2,43020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.
Description
CCL8 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P80075.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP80075
Synonyms
Small-inducible cytokine A8,SCYA8,SCYA10,Monocyte chemotactic protein 2 (MCP-2),Monocyte chemoattractant protein 2,MCP2,HC14,CCL8,C-C motif chemokine 8
Amino Acid
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Construction
24-99 aa
Protein Purity
>96% as determined by SDS-PAGE.
Molecular Weight8.9 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords