Shopping Cart
- Remove All
- Your shopping cart is currently empty
CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $130 | 20 days | |
10 μg | $198 | 20 days | |
20 μg | $338 | 20 days | |
50 μg | $655 | 20 days | |
100 μg | $1,080 | 20 days | |
200 μg | $1,530 | 20 days | |
500 μg | $2,430 | 20 days |
Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml. |
Description | CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501. |
Species | Human |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P13501 |
Synonyms | T-cell-specific protein RANTES,T cell-specific protein P228 (TCP228),Small-inducible cytokine A5,SIS-delta,SCYA5,Eosinophil chemotactic cytokine,EoCP,D17S136E,CCL5,C-C motif chemokine 5 |
Amino Acid | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Construction | 24-91 aa |
Protein Purity | >98% as determined by SDS-PAGE. |
Molecular Weight | 7.8 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 100 mM NaCl |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.