Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL5 Protein, Human, Recombinant (Active)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03855

CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.

CCL5 Protein, Human, Recombinant (Active)

CCL5 Protein, Human, Recombinant (Active)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03855
CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.
Pack SizePriceAvailabilityQuantity
5 μg$147In Stock
10 μg$223In Stock
20 μg$382In Stock
50 μg$739In Stock
100 μg$1,220In Stock
200 μg$1,7207-10 days
500 μg$2,730In Stock
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml.
Description
CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP13501
Synonyms
T-cell-specific protein RANTES,T cell-specific protein P228 (TCP228),Small-inducible cytokine A5,SIS-delta,SCYA5,Eosinophil chemotactic cytokine,EoCP,D17S136E,CCL5,C-C motif chemokine 5
Amino Acid
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Construction
24-91 aa
Protein Purity
>98% as determined by SDS-PAGE.
Molecular Weight7.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 100 mM NaCl
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords