Shopping Cart
- Remove All
Your shopping cart is currently empty
CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $147 | In Stock | |
| 10 μg | $223 | In Stock | |
| 20 μg | $382 | In Stock | |
| 50 μg | $739 | In Stock | |
| 100 μg | $1,220 | In Stock | |
| 200 μg | $1,720 | 7-10 days | |
| 500 μg | $2,730 | In Stock |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml. |
| Description | CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P13501 |
| Synonyms | T-cell-specific protein RANTES,T cell-specific protein P228 (TCP228),Small-inducible cytokine A5,SIS-delta,SCYA5,Eosinophil chemotactic cytokine,EoCP,D17S136E,CCL5,C-C motif chemokine 5 |
| Amino Acid | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Construction | 24-91 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Molecular Weight | 7.8 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 100 mM NaCl |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.