Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL4L1 Protein, Human, Recombinant

TargetMol | SPR
Catalog No. TMPH-03854 Copy Product Info
CCL4L1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8NHW4.

CCL4L1 Protein, Human, Recombinant

Catalog No. TMPH-03854
Copy Product Info
TargetMol | SPR

CCL4L1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8NHW4.

CCL4L1 Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$1477-10 days7-10 days
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human CCR5 transfected murine BaF3 cells is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
Description
CCL4L1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8NHW4.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ8NHW4
Synonyms
Small-inducible cytokine A4-like,SCYA4L2,SCYA4L1,Monocyte adherence-induced protein 5-alpha,Macrophage inflammatory protein 1-beta (MIP-1-beta),Lymphocyte activation gene 1 protein (LAG-1),LAG1,CCL4L2,CCL4L1,CCL4L,C-C motif chemokine 4-like
Amino Acid
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Construction
24-92 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight7.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords