Shopping Cart
- Remove All
- Your shopping cart is currently empty
CCL4 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P14097.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $223 | 7-10 days | |
10 μg | $368 | 7-10 days | |
20 μg | $529 | 7-10 days | |
50 μg | $848 | 7-10 days | |
100 μg | $1,220 | 7-10 days | |
200 μg | $1,720 | 7-10 days | |
500 μg | $2,730 | 7-10 days |
Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 20-100 ng/ml. |
Description | CCL4 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P14097. |
Species | Mouse |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P14097 |
Synonyms | Small-inducible cytokine A4,SIS-gamma,Scya4,Protein H400,Mip1b,Macrophage inflammatory protein 1-beta (MIP-1-beta),Immune activation protein 2 (ACT-2;ACT2),Ccl4,C-C motif chemokine 4 |
Amino Acid | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
Construction | 24-92 aa |
Protein Purity | >97% as determined by SDS-PAGE. |
Molecular Weight | 7.8 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm filtered 2X PBS, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.