Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

CCL3 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10147.

Human

E. coli

Tonsillar lymphocyte LD78 alpha protein,Small-inducible cytokine A3,SIS-beta,SCYA3,PAT 464.1,MIP1A,Macrophage inflammatory protein 1-alpha (MIP-1-alpha),G0S19-1,G0/G1 switch regulatory protein 19-1,CCL3,C-C motif chemokine 3

ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

23-92 aa

>96% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.