Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL3 Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-03851

CCL3 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10147.

CCL3 Protein, Human, Recombinant (Active)

CCL3 Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-03851
CCL3 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10147.
Pack SizePriceAvailabilityQuantity
5 μg$13020 days
10 μg$19820 days
20 μg$33820 days
50 μg$65520 days
100 μg$1,08020 days
200 μg$1,53020 days
500 μg$2,43020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Description
CCL3 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10147.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP10147
Synonyms
Tonsillar lymphocyte LD78 alpha protein,Small-inducible cytokine A3,SIS-beta,SCYA3,PAT 464.1,MIP1A,Macrophage inflammatory protein 1-alpha (MIP-1-alpha),G0S19-1,G0/G1 switch regulatory protein 19-1,CCL3,C-C motif chemokine 3
Amino Acid
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Construction
23-92 aa
Protein Purity
>96% as determined by SDS-PAGE.
Molecular Weight7.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords