Shopping Cart
- Remove All
- Your shopping cart is currently empty
CCL27 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9Y4X3.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $147 | 7-10 days | |
10 μg | $246 | 7-10 days | |
20 μg | $416 | 7-10 days | |
50 μg | $853 | 7-10 days | |
100 μg | $1,460 | 7-10 days | |
200 μg | $1,980 | 7-10 days | |
500 μg | $3,300 | 7-10 days |
Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CCR10 transfected BaF3 cells is in a concentration range of 10-100 ng/ml. |
Description | CCL27 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9Y4X3. |
Species | Human |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | Q9Y4X3 |
Synonyms | Small-inducible cytokine A27,Skinkine,SCYA27,ILC,IL-11 R-alpha-locus chemokine,ESkine,Cutaneous T-cell-attracting chemokine (CTACK),CCL27,C-C motif chemokine 27,CC chemokine ILC |
Amino Acid | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Construction | 25-112 aa |
Protein Purity | >96% as determined by SDS-PAGE. |
Molecular Weight | 10.1 kDa (Predicted) |
Endotoxin | < 0.1 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.