Shopping Cart
- Remove All
- Your shopping cart is currently empty
CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $130 | 20 days | |
100 μg | $1,300 | 20 days | |
500 μg | $2,920 | 20 days |
Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-50 ng/ml. |
Description | CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903. |
Species | Mouse |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | O35903 |
Synonyms | Thymus-expressed chemokine,Teck,Small-inducible cytokine A25,Scya25,Chemokine TECK,Ccl25,C-C motif chemokine 25 |
Amino Acid | QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN |
Construction | 24-144 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 14.1 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.