Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL25 Protein, Mouse, Recombinant

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04227

CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903.

CCL25 Protein, Mouse, Recombinant

CCL25 Protein, Mouse, Recombinant

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04227
CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$1477-10 days7-10 days
10 μg$2467-10 days7-10 days
20 μg$4167-10 days7-10 days
50 μg$8537-10 days7-10 days
100 μg$1,4607-10 days7-10 days
200 μg$1,9807-10 days7-10 days
500 μg$3,3007-10 days7-10 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-50 ng/ml.
Description
CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberO35903
Synonyms
Thymus-expressed chemokine,Teck,Small-inducible cytokine A25,Scya25,Chemokine TECK,Ccl25,C-C motif chemokine 25
Amino Acid
QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Construction
24-144 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight14.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords