Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL25 Protein, Human, Recombinant

TargetMol | SPR
Catalog No. TMPH-03847 Copy Product Info
CCL25 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O15444.

CCL25 Protein, Human, Recombinant

Catalog No. TMPH-03847
Copy Product Info
TargetMol | SPR

CCL25 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O15444.

CCL25 Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$1477-10 days7-10 days
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Description
CCL25 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O15444.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO15444
Synonyms
Thymus-expressed chemokine,TECK,Small-inducible cytokine A25,SCYA25,Chemokine TECK,CCL25,C-C motif chemokine 25
Amino Acid
M+QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Construction
24-150 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight14.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords