Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL25 Protein, Human, Recombinant

(Synonyms: Thymus-expressed chemokine, TECK, Small-inducible cytokine A25, SCYA25, Chemokine TECK, CCL25, C-C motif chemokine 25) Copy Product Info

Synonyms: Thymus-expressed chemokine, TECK, Small-inducible cytokine A25, SCYA25, Chemokine TECK, CCL25, C-C motif chemokine 25

Catalog No. TMPH-03847 Copy Product Info
CCL25 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O15444.
CCL25 Protein, Human, Recombinant
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$1477-10 days7-10 days
10 µg$2237-10 days7-10 days
20 µg$3827-10 days7-10 days
50 µg$7397-10 days7-10 days
100 µg$1,2207-10 days7-10 days
200 µg$1,7207-10 days7-10 days
500 µg$2,7307-10 days7-10 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Description
CCL25 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is O15444.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO15444
Amino AcidM+QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Construction24-150 aa
Protein Purity
>97% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
ReconstitutionReconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
SynonymsThymus-expressed chemokine, TECK, Small-inducible cytokine A25, SCYA25, Chemokine TECK, CCL25, C-C motif chemokine 25
Chemical Properties
Molecular Weight14.3 kDa (Predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Keywords

Related Tags: CCL25 Protein, Human, Recombinant chemical structure | CCL25 Protein, Human, Recombinant molecular weight