Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL24 Protein, Mouse, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-04226

CCL24 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9JKC0.

CCL24 Protein, Mouse, Recombinant (Active)

CCL24 Protein, Mouse, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-04226
CCL24 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9JKC0.
Pack SizePriceAvailabilityQuantity
5 μg$1477-10 days
10 μg$2237-10 days
20 μg$3827-10 days
50 μg$7397-10 days
100 μg$1,2207-10 days
200 μg$1,7207-10 days
500 μg$2,7307-10 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 10-100 ng/ml.
Description
CCL24 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is Q9JKC0.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ9JKC0
Synonyms
Small-inducible cytokine A24,Scya24,Eosinophil chemotactic protein 2 (Eotaxin-2),Ccl24,C-C motif chemokine 24
Amino Acid
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Construction
27-119 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight10.3 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords