Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL21 Protein, Human, Recombinant (E. coli)

TargetMol | SPR
Catalog No. TMPH-03843 Copy Product Info
CCL21 Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is O00585.

CCL21 Protein, Human, Recombinant (E. coli)

Catalog No. TMPH-03843
Copy Product Info
TargetMol | SPR

CCL21 Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is O00585.

CCL21 Protein, Human, Recombinant (E. coli)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$1477-10 days7-10 days
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 10-100 ng/ml.
Description
CCL21 Protein, Human, Recombinant (E. coli) is expressed in E. coli with Tag Free. The accession number is O00585.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO00585
Synonyms
Small-inducible cytokine A21,Secondary lymphoid-tissue chemokine (SLC),SCYA21,CCL21,C-C motif chemokine 21,Beta-chemokine exodus-2,6Ckine
Amino Acid
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Construction
24-134 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight12.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in 2 × PBS, pH 7.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords