Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL20 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03842

CCL20 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P78556.

CCL20 Protein, Human, Recombinant

CCL20 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03842
CCL20 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P78556.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$1477-10 days7-10 days
10 μg$2237-10 days7-10 days
20 μg$3827-10 days7-10 days
50 μg$7397-10 days7-10 days
100 μg$1,2207-10 days7-10 days
200 μg$1,7207-10 days7-10 days
500 μg$2,7307-10 days7-10 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-50 ng/ml.
Description
CCL20 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P78556.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP78556
Synonyms
Small-inducible cytokine A20,SCYA20,MIP3A,Macrophage inflammatory protein 3 alpha (MIP-3-alpha),Liver and activation-regulated chemokine,LARC,CCL20,C-C motif chemokine 20,CC chemokine LARC,Beta-chemokine exodus-1
Amino Acid
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Construction
27-96 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight8.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords