CCL20 Protein, Human, Recombinant

Name: CCL20 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-03842
Rating: 4.5 (1 reviews)

(Synonyms: Small-inducible cytokine A20, SCYA20, MIP3A, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, LARC, CCL20, C-C motif chemokine 20, CC chemokine LARC, Beta-chemokine exodus-1) Copy Product Info

Synonyms: Small-inducible cytokine A20, SCYA20, MIP3A, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, LARC, CCL20, C-C motif chemokine 20, CC chemokine LARC, Beta-chemokine exodus-1

Catalog No. TMPH-03842 Copy Product Info

CCL20 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P78556.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$147	7-10 days	7-10 days
10 μg	$223	7-10 days	7-10 days
20 μg	$382	7-10 days	7-10 days
50 μg	$739	7-10 days	7-10 days
100 μg	$1,220	7-10 days	7-10 days
200 μg	$1,720	7-10 days	7-10 days
500 μg	$2,730	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-50 ng/ml.
Description	CCL20 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P78556.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P78556
Amino Acid	ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Construction	27-96 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Small-inducible cytokine A20, SCYA20, MIP3A, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Liver and activation-regulated chemokine, LARC, CCL20, C-C motif chemokine 20, CC chemokine LARC, Beta-chemokine exodus-1

Chemical Properties

Molecular Weight

8.0 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

β-chemokine exodus-1SCYA 20MIP3-αMIP-3-αMIP3-alphaMIP-3-alphaMIP3-aMIP-3-aMacrophage inflammatory protein 3 α (MIP-3-α)Macrophage inflammatory protein 3 a (MIP-3-a)CCL 20CC-chemokine LARCb-chemokine exodus-1

Related Tags: CCL20 Protein, Human, Recombinant chemical structure | CCL20 Protein, Human, Recombinant molecular weight