Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CCL19/MIP-3b Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04222

CCL19/MIP-3b Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O70460.

CCL19/MIP-3b Protein, Mouse, Recombinant

CCL19/MIP-3b Protein, Mouse, Recombinant

TargetMol | SPR
Catalog No. TMPH-04222
CCL19/MIP-3b Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O70460.
Pack SizePriceAvailabilityQuantity
5 μg$13020 days
100 μg$1,08020 days
500 μg$2,43020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml.
Description
CCL19/MIP-3b Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O70460.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberO70460
Synonyms
Small-inducible cytokine A19,Scya19,Epstein-Barr virus-induced molecule 1 ligand chemokine (EBI1 ligand chemokine;ELC),Elc,Ccl19,C-C motif chemokine 19
Amino Acid
GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Construction
26-108 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight9.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords