Shopping Cart
Remove All
Your shopping cart is currently empty
Cardiac phospholamban/PLN Protein, Human, Recombinant (GST)
(Synonyms: PLN, PLB, Phospholamban) Copy Product InfoSynonyms: PLN, PLB, Phospholamban
Catalog No. TMPH-01049 Copy Product Info
Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $86 | 20 days | 20 days | |
| 10 µg | $138 | 20 days | 20 days | |
| 20 µg | $231 | 20 days | 20 days | |
| 50 µg | $348 | 20 days | 20 days | |
| 100 µg | $480 | 20 days | 20 days | |
| 200 µg | $743 | 20 days | 20 days | |
| 500 µg | $1,330 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-GST |
| Accession Number | P26678 |
| Amino Acid | MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL |
| Construction | 1-52 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | PLN, PLB, Phospholamban |
| Research Background | Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation. |
| Molecular Weight | 33.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) chemical structure | Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.