Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cardiac phospholamban/PLN Protein, Human, Recombinant (GST)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01049 Copy Product Info
Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678.

Cardiac phospholamban/PLN Protein, Human, Recombinant (GST)

Catalog No. TMPH-01049
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678.

Cardiac phospholamban/PLN Protein, Human, Recombinant (GST)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$8620 days20 days
10 μg$13820 days20 days
20 μg$23120 days20 days
50 μg$34820 days20 days
100 μg$48020 days20 days
200 μg$74320 days20 days
500 μg$1,33020 days20 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-GST
Accession NumberP26678
Synonyms
PLN,PLB,Phospholamban
Amino Acid
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Construction
1-52 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight33.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.