Home Tools
Log in
Cart

Car b 1 isoform 2 Protein, Carpinus betulus, Recombinant (His)

Catalog No. TMPH-00348
Synonyms: Major pollen allergen Car b 1 isoform 2, Car b 1, Allergen Car b I

Car b 1 isoform 2 Protein, Carpinus betulus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.4 kDa and the accession number is P38950.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Car b 1 isoform 2 Protein, Carpinus betulus, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description Car b 1 isoform 2 Protein, Carpinus betulus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.4 kDa and the accession number is P38950.
Species Carpinus betulus
Expression System E. coli
Tag N-6xHis
Accession Number P38950
Synonyms Major pollen allergen Car b 1 isoform 2, Car b 1, Allergen Car b I
Amino Acid GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Construction 2-160 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 21.4 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Car b 1 isoform 2 Protein, Carpinus betulus, Recombinant (His) Major pollen allergen Car b 1 isoform 2 Car b 1 Allergen Car b I recombinant recombinant-proteins proteins protein

 

TargetMol