Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CACNG1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04542 Copy Product Info
CACNG1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q06432.

CACNG1 Protein, Human, Recombinant (His)

Catalog No. TMPH-04542
Copy Product Info
TargetMol | SPR

CACNG1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q06432.

CACNG1 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23520 days20 days
20 μg$39320 days20 days
50 μg$56820 days20 days
100 μg$75620 days20 days
200 μg$1,08020 days20 days
500 μg$1,76020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CACNG1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q06432.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ06432
Synonyms
Voltage-dependent calcium channel gamma-1 subunit,Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma,CACNLG,CACNG1
Amino Acid
DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAA
Construction
30-108 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight16 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 179 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords