Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00263 Copy Product Info
Bovine coronavirus (strain OK-0514) Spike glycoprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9QAQ8.

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)

Catalog No. TMPH-00263
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9QAQ8.

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13320 days20 days
10 μg$21920 days20 days
20 μg$36820 days20 days
50 μg$67820 days20 days
100 μg$1,08020 days20 days
200 μg$1,68020 days20 days
500 μg$2,97020 days20 days
1 mg$4,77020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Bovine coronavirus (strain OK-0514) Spike glycoprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9QAQ8.
Species
BCoV
Expression System
HEK293 Cells
TagC-6xHis
Accession NumberQ9QAQ8
Synonyms
Spike glycoprotein,S glycoprotein,Peplomer protein,E2
Amino Acid
TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCRPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Construction
314-634 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight37.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords