Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. |
Species | Mouse |
Expression System | E. coli |
Tag | C-terminal 6xHis-tagged |
Accession Number | Q8BHE5 |
Synonyms | Bone morphogenetic protein 3, Bmp3, BMP-3 |
Amino Acid | QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 359-468 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 14.4 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
BMP3 Protein, Mouse, Recombinant (Myc) Bone morphogenetic protein 3 Bmp3 BMP-3 recombinant recombinant-proteins proteins protein