Home Tools
Log in
Cart

BMP-3 Protein, Human, Recombinant (His)

Catalog No. TMPH-01015
Synonyms: BMP3A, Bone morphogenetic protein 3A, BMP3, Osteogenin, Bone morphogenetic protein 3, BMP-3A, BMP-3

Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
BMP-3 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways.
Species Human
Expression System E. coli
Tag N-terminal 6xHis-tagged
Accession Number P12645
Synonyms BMP3A, Bone morphogenetic protein 3A, BMP3, Osteogenin, Bone morphogenetic protein 3, BMP-3A, BMP-3
Amino Acid QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 363-472 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 16.4 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

BMP-3 Protein, Human, Recombinant (His) BMP3A Bone morphogenetic protein 3A BMP3 Osteogenin Bone morphogenetic protein 3 BMP-3A BMP-3 recombinant recombinant-proteins proteins protein

 

TargetMol