Home Tools
Log in
Cart

BMP-15 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01013
Synonyms: BMP15, GDF-9B, BMP-15, Bone morphogenetic protein 15, GDF9B, Growth/differentiation factor 9B

May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
BMP-15 Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Species Human
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number O95972
Synonyms BMP15, GDF-9B, BMP-15, Bone morphogenetic protein 15, GDF9B, Growth/differentiation factor 9B
Amino Acid QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 268-392 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 21.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

BMP-15 Protein, Human, Recombinant (His & Myc) BMP15 GDF-9B BMP-15 Bone morphogenetic protein 15 GDF9B Growth/differentiation factor 9B recombinant recombinant-proteins proteins protein

 

TargetMol