Home Tools
Log in
Cart

BjaIT Protein, Hottentotta judaicus, Recombinant (His & Myc)

Catalog No. TMPH-00837
Synonyms: Alpha-insect toxin BjaIT, Bj-alpha-IT

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects (para/tipE).

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
BjaIT Protein, Hottentotta judaicus, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects (para/tipE).
Species Hottentotta judaicus
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number Q56TT9
Synonyms Alpha-insect toxin BjaIT, Bj-alpha-IT
Amino Acid GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 20-83 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 14.4 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects (para/tipE).

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

BjaIT Protein, Hottentotta judaicus, Recombinant (His & Myc) Alpha-insect toxin BjaIT Bj-alpha-IT recombinant recombinant-proteins proteins protein

 

TargetMol