Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)

Catalog No. TMPH-00361

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)

Catalog No. TMPH-00361
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$84520 days
1 mg$2,97020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.
Species
Centruroides noxius
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP01495
Synonyms
Toxin II.9.2.2,Toxin 2,Beta-mammal toxin Cn2
Amino Acid
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Construction
17-82 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight9.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords