Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00361 Copy Product Info
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)

Catalog No. TMPH-00361
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.

Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,23020 days20 days
500 μg$1,98020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.6 kDa and the accession number is P01495.
Species
Centruroides noxius
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP01495
Synonyms
Toxin II.9.2.2,Toxin 2,Beta-mammal toxin Cn2
Amino Acid
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Construction
17-82 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight9.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords