Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 397.00 | |
100 μg | 20 days | $ 769.00 | |
1 mg | 20 days | $ 2,760.00 |
Description | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. |
Species | Centruroides noxius |
Expression System | Yeast |
Tag | N-terminal 6xHis-tagged |
Accession Number | P01495 |
Synonyms | Toxin 2, Beta-mammal toxin Cn2, Toxin II.9.2.2 |
Amino Acid | KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 17-82 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 9.6 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Beta-mammal toxin Cn2 Protein, Centruroides noxius, Recombinant (His) Toxin 2 Beta-mammal toxin Cn2 Toxin II.9.2.2 recombinant recombinant-proteins proteins protein