BCL2 Protein, Mouse, Recombinant (His)

Name: BCL2 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02520
Rating: 4.5 (1 reviews)

(Synonyms: Bcl-2, Bcl2, Apoptosis regulator Bcl-2) Copy Product Info

Synonyms: Bcl-2, Bcl2, Apoptosis regulator Bcl-2

Catalog No. TMPH-02520 Copy Product Info

BCL2 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.7 kDa and the accession number is P10417.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	BCL2 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.7 kDa and the accession number is P10417.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	P10417
Amino Acid	GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
Construction	5-205 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Bcl-2, Bcl2, Apoptosis regulator Bcl-2
Research Background	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.

Chemical Properties

Molecular Weight

26.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.