Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ATP5O Protein, Human, Recombinant (GST)

Catalog No. TMPH-00969

ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli.

ATP5O Protein, Human, Recombinant (GST)

ATP5O Protein, Human, Recombinant (GST)

Catalog No. TMPH-00969
ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$19820 days
100 μg$42720 days
1 mg$1,83020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberP48047
Synonyms
Oligomycin sensitivity conferral protein (OSCP),mitochondrial,ATPO,ATP5PO,ATP5O,ATP synthase subunit O, mitochondrial,ATP synthase peripheral stalk subunit OSCP
Amino Acid
FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Construction
24-213 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight47.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords