Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Oligomycin sensitivity conferral protein (OSCP), mitochondrial, ATPO, ATP5PO, ATP5O, ATP synthase subunit O, mitochondrial, ATP synthase peripheral stalk subunit OSCP


| Pack Size | Price | EUR Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | 67 € | 20 days | 20 days | |
| 10 µg | 107 € | 20 days | 20 days | |
| 20 µg | 178 € | 20 days | 20 days | |
| 50 µg | 267 € | 20 days | 20 days | |
| 100 µg | 384 € | 20 days | 20 days | |
| 200 µg | 592 € | 20 days | 20 days | |
| 500 µg | 1.053 € | 20 days | 20 days | |
| 1 mg | 1.647 € | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ATP5O Protein, Human, Recombinant (GST) is expressed in E. coli. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | P48047 |
| Amino Acid | FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
| Construction | 24-213 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Oligomycin sensitivity conferral protein (OSCP), mitochondrial, ATPO, ATP5PO, ATP5O, ATP synthase subunit O, mitochondrial, ATP synthase peripheral stalk subunit OSCP |
| Research Background | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. |
| Molecular Weight | 47.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.